PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 180aa    MW: 20310.2 Da    PI: 9.5978
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1982genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.97.9e-0780116541
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeae 41 
                  k+ +r++ NR +A++sR+R+ +++++Le+k++ Lea 
  Gh_A01G1982  80 KKLKRLIANRASAQKSRLRRVEYVDKLEKKAEFLEAT 116
                  899******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-976140IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.86478141IPR004827Basic-leucine zipper domain
PfamPF001706.0E-880116IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.3E-980145No hitNo description
SuperFamilySSF579593.26E-880134No hitNo description
CDDcd147034.36E-1181132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MDPKNETSPN AADNQMLNPN AENEDLTLPL ESIQPLHKRS ASDSLAFVKE PYWHAPSSSA  60
QGRLLGGAAG SSSASHMDPK KLKRLIANRA SAQKSRLRRV EYVDKLEKKA EFLEATASLV  120
SPRVTSERKK RMMLLKENAE LKQKIEFYDK LLEKQDAEYK ALKEERDLLS FTNLLIQEGI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468537.11e-113PREDICTED: basic leucine zipper 19-like isoform X1
TrEMBLA0A0D2QCI61e-113A0A0D2QCI6_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1865168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.22e-17bZIP family protein